Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G01180_circ_g.4 |
ID in PlantcircBase | ath_circ_019037 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr3: 63762-64001 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT3G01180 |
Parent gene annotation |
Starch synthase, chloroplastic/amyloplastic (Fragment) |
Parent gene strand | - |
Alternative splicing | AT3G01180_circ_g.1 AT3G01180_circ_g.2 AT3G01180_circ_g.3 AT3G01180_circ_g.5 |
Support reads | 6 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT3G01180.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.257001037 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
63999-63764(-) |
Potential amino acid sequence |
MEVMYFHAFIDGVDFVFIDSPEFRHLSNNIYGGNRLDILKRMVLFCKAAVEDMEVMYFHAFIDG VDFVFIDSPEFRHLSNNIYGGNRLDILKRMVLFCKAAVEDMEVMYFHAFIDGVDFVFIDSPEFR HLSNNIYGGNRLDILKRMVLFCKAAVEDMEVMYFHAFIDGVDFVFIDSPEFRHLSNNIYGGNRL DILKRMVLFCKAAVE(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |