Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0128200_circ_g.1 |
| ID in PlantcircBase | osa_circ_012929 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 1457825-1458679 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0128200 |
| Parent gene annotation |
Similar to Transcription factor HBP-1a (Histone-specific transcr iption factor HBP1). (Os02t0128200-01);Similar to Transcription factor HBP-1a (Histone-specific transcription factor HBP1). (Os0 2t0128200-02) |
| Parent gene strand | + |
| Alternative splicing | Os02g0128200_circ_g.2 Os02g0128200_circ_g.3 Os02g0128200_circ_g.4 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0128200-01:3 Os02t0128200-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_003624* osi_circ_011649 |
| PMCS | 0.116276667 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1457919-1457872(+) 1457929-1457906(+) 1458468-1457925(+) |
| Potential amino acid sequence |
MGTNDPGTPSKATKASEPEQSPATTSGTTAPVYPEWPGFQAYSAIPPHGFFPPPVAASPQAHPY MWGAQVAFLLSQFINIRVTME*(+) MILARRPRQQRHQNRSSLQPLHLALQLQFTLNGLVFRPTRQFHRMGSFHLLLLQVPRLIPTCGE LRWPFCYHNLSISGLQWNECASLVAGKHC*(+) MAWFSGLLGNSTAWVLSTSCCCKSPGSSLHVGSSGGLFAITIYQYPGYNGMSVRVWLPGSIVDE SDGY*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |