Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0128200_circ_g.1 |
ID in PlantcircBase | osa_circ_012929 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 1457825-1458679 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0128200 |
Parent gene annotation |
Similar to Transcription factor HBP-1a (Histone-specific transcr iption factor HBP1). (Os02t0128200-01);Similar to Transcription factor HBP-1a (Histone-specific transcription factor HBP1). (Os0 2t0128200-02) |
Parent gene strand | + |
Alternative splicing | Os02g0128200_circ_g.2 Os02g0128200_circ_g.3 Os02g0128200_circ_g.4 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0128200-01:3 Os02t0128200-02:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_003624* osi_circ_011649 |
PMCS | 0.116276667 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1457919-1457872(+) 1457929-1457906(+) 1458468-1457925(+) |
Potential amino acid sequence |
MGTNDPGTPSKATKASEPEQSPATTSGTTAPVYPEWPGFQAYSAIPPHGFFPPPVAASPQAHPY MWGAQVAFLLSQFINIRVTME*(+) MILARRPRQQRHQNRSSLQPLHLALQLQFTLNGLVFRPTRQFHRMGSFHLLLLQVPRLIPTCGE LRWPFCYHNLSISGLQWNECASLVAGKHC*(+) MAWFSGLLGNSTAWVLSTSCCCKSPGSSLHVGSSGGLFAITIYQYPGYNGMSVRVWLPGSIVDE SDGY*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |