Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0825700_circ_g.2 |
ID in PlantcircBase | osa_circ_004662 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 35315991-35316519 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0825700 |
Parent gene annotation |
Similar to VHS2 protein (Fragment). (Os01t0825700-01) |
Parent gene strand | - |
Alternative splicing | Os01g0825700_circ_g.3 Os01g0825700_circ_g.4 Os01g0825700_circ_g.5 Os01g0825700_circ_g.6 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0825700-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_010888 |
PMCS | 0.150757467 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
35316452-35316193(+) 35316398-35316515(-) 35316040-35316515(-) |
Potential amino acid sequence |
MCRRGCKYRWCIYRTPWEHGTYPPVELTNCMSFCWFERHWLTRSVIISSLTAM*(+) MSSDVETLSLGDLNNIRNVTELLCDMVHALNPSDHMAVKDEIITDLVSQCRSNQQKLMQFVSST GG*(-) MSLKPTKAHAVCQLNRRIGAVFPRRPIDAPPIFTPPATHTSQSYGSPRYEAGSLNEIMSSDVET LSLGDLNNIRNVTELLCDMVHALNPSDHMAVKDEIITDLVSQCRSNQQKLMQFVSSTGG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |