Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0825700_circ_g.2 |
| ID in PlantcircBase | osa_circ_004662 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 35315991-35316519 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0825700 |
| Parent gene annotation |
Similar to VHS2 protein (Fragment). (Os01t0825700-01) |
| Parent gene strand | - |
| Alternative splicing | Os01g0825700_circ_g.3 Os01g0825700_circ_g.4 Os01g0825700_circ_g.5 Os01g0825700_circ_g.6 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0825700-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_010888 |
| PMCS | 0.150757467 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
35316452-35316193(+) 35316398-35316515(-) 35316040-35316515(-) |
| Potential amino acid sequence |
MCRRGCKYRWCIYRTPWEHGTYPPVELTNCMSFCWFERHWLTRSVIISSLTAM*(+) MSSDVETLSLGDLNNIRNVTELLCDMVHALNPSDHMAVKDEIITDLVSQCRSNQQKLMQFVSST GG*(-) MSLKPTKAHAVCQLNRRIGAVFPRRPIDAPPIFTPPATHTSQSYGSPRYEAGSLNEIMSSDVET LSLGDLNNIRNVTELLCDMVHALNPSDHMAVKDEIITDLVSQCRSNQQKLMQFVSSTGG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |