Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0519400_circ_g.5 |
| ID in PlantcircBase | osa_circ_028543 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 25783526-25784946 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0519400 |
| Parent gene annotation |
Homologue of NSF (N-ethylmaleimide sensitive factor), ATPase, Re gulation of vacuolar morphology in endosperm cell (Os05t0519400- 01);Similar to predicted protein. (Os05t0519400-02);Similar to p redicted protein. (Os05t0519400-03) |
| Parent gene strand | - |
| Alternative splicing | Os05g0519400_circ_g.3 Os05g0519400_circ_g.4 Os05g0519400_circ_g.6 Os05g0519400_circ_g.7 Os05g0519400_circ_g.8 Os05g0519400_circ_g.9 Os05g0519400_circ_g.10 Os05g0519400_circ_g.11 Os05g0519400_circ_g.12 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0519400-02:4 Os05t0519400-03:4 Os05t0519400-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.267655425 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25784872-25783530(+) 25784863-25784922(-) |
| Potential amino acid sequence |
MNLKNLQTAIFIRQVYLNMNFQSSRQF*(+) MKESSFLSPNVNLQELAARTKNYSGAELEGVVKSAVSYALNRQISMDDLTKPLDEESIKVTMDD FVNALHEITPAFGASTDDLERCRLRGMVDCGKAHRHLYERGMLLVEQVKVSKGSPLVTCLLEGP AGSGKSALAATVGIDSDFAYVKIAWTIGSSY*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |