Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G67950_circ_g.1 |
| ID in PlantcircBase | ath_circ_009140 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 25479446-25479874 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | AT1G67950 |
| Parent gene annotation |
RNA-binding (RRM/RBD/RNP motifs) family protein |
| Parent gene strand | - |
| Alternative splicing | AT1G67950_circ_g.2 |
| Support reads | 2 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G67950.3:3 AT1G67950.1:3 AT1G67950.4:3 AT1G67950.2:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.170429327 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25479779-25479448(-) |
| Potential amino acid sequence |
MRSETQESQVAYVTFKDSQGAETAMLLTGAVIADLRVSITPAVNYQLPPEALALDSVKTVKISN VSLIVSKKDVKEFFSFSGDIQYVEMRSETQESQVAYVTFKDSQGAETAMLLTGAVIADLRVSIT PAVNYQLPPEALALDSVKTVKISNVSLIVSKKDVKEFFSFSGDIQYVEMRSETQESQVAYVTFK DSQGAETAMLLTGAVIADLRVSITPAVNYQLPPEALALDSVKTVKISNVSLIVSKKDVKEFFSF SGDIQYVEMRSETQESQVAYVTFKDSQGAETAMLLTGAVIADLRVSITPAVNYQLPPEALALDS (-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |