Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | BGIOSGA028211_circ_g.7 |
| ID in PlantcircBase | osi_circ_007607 |
| Alias | 8:8046978|8047639 |
| Organism | Oryza sativa ssp. indica |
| Position | chr8: 8046978-8047639 JBrowse» |
| Reference genome | Oryza_indica.ASM465v1.42 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | BGIOSGA028211 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | BGIOSGA028211_circ_g.2 BGIOSGA028211_circ_g.3 BGIOSGA028211_circ_g.4 BGIOSGA028211_circ_g.5 BGIOSGA028211_circ_g.6 BGIOSGA028211_circ_g.8 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | BGIOSGA028211-TA:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osa_circ_036379* osa_circ_036378 |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8047031-8047278(-) 8047582-8046984(+) 8047023-8047028(+) |
| Potential amino acid sequence |
MSIATSSRAPTPPFSRAPDGWPSITAKSEMNCPCLLHNIQLLKGVQHATRPKIQLLSYTYSSFF PLEELPR*(-) MQKTRAIHLRFGGYTGPAIRCS*(+) MDMKARGMYVCRTLSYKGAAFATVEAPLEERMMNMYRKAAEFWAELRVELLSAIEYYAEDKGNS SQIWRLYWASHQVLLRKVVWVLLNLLLWT*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Huang et al., 2021 |