Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0118900_circ_g.3 |
| ID in PlantcircBase | osa_circ_022933 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 1123107-1123597 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0118900 |
| Parent gene annotation |
Similar to Arginine/serine-rich splicing factor 1 variant 2. (Os 04t0118900-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 4 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0118900-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_014222 |
| PMCS | 0.189992719 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1123193-1123578(-) |
| Potential amino acid sequence |
MFGSGGTLLLCSLKHRKRPQKHLKLLILRFAFVYFEDERDGDEAIRALDGYPFGPGRRRLSVEW SRGDRGSRRDGYSKPPVNTKPTKTLFVINFDPINTRVTDIERHFEPFGKLSNVRIRRNFAFVQF ETQEEATKALEATHSTICFCLL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |