Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0118900_circ_g.3 |
ID in PlantcircBase | osa_circ_022933 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 1123107-1123597 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os04g0118900 |
Parent gene annotation |
Similar to Arginine/serine-rich splicing factor 1 variant 2. (Os 04t0118900-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 4 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0118900-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_014222 |
PMCS | 0.189992719 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1123193-1123578(-) |
Potential amino acid sequence |
MFGSGGTLLLCSLKHRKRPQKHLKLLILRFAFVYFEDERDGDEAIRALDGYPFGPGRRRLSVEW SRGDRGSRRDGYSKPPVNTKPTKTLFVINFDPINTRVTDIERHFEPFGKLSNVRIRRNFAFVQF ETQEEATKALEATHSTICFCLL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |