Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G44100_circ_g.3 |
ID in PlantcircBase | ath_circ_018278 |
Alias | AT2G44100_C1 |
Organism | Arabidpsis thaliana |
Position | chr2: 18242240-18242671 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, CIRI2 |
Parent gene | AT2G44100 |
Parent gene annotation |
Guanosine nucleotide diphosphate dissociation inhibitor 1 |
Parent gene strand | + |
Alternative splicing | AT2G44100_circ_g.1 AT2G44100_circ_g.2 AT2G44100_circ_g.4 AT2G44100_circ_g.5 AT2G44100_circ_g.6 AT2G44100_circ_g.7 AT2G44100_circ_g.8 |
Support reads | 1 |
Tissues | root, aerial, leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT2G44100.1:3 AT2G44100.2:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.33777155 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
18242249-18242668(+) |
Potential amino acid sequence |
MDRNDYYGGESTSLNLNQLWKKFRGEEKAPAHLGSSRDYNVDMMPKFMMANGKLVRVLIHTDVT KYLSFKAVDGSYVFVQGKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEKAPAHLGSSRDYNVDM MPKFMMANGKLVRVLIHTDVTKYLSFKAVDGSYVFVQGKVLHMDRNDYYGGESTSLNLNQLWKK FRGEEKAPAHLGSSRDYNVDMMPKFMMANGKLVRVLIHTDVTKYLSFKAVDGSYVFVQGKVLHM DRNDYYGGESTSLNLNQLWKKFRGEEKAPAHLGSSRDYNVDMMPKFMMANGKLVRVLIHTDVTK YLSFKAVDGSYVFVQGK(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Chu et al., 2017;Zhang et al., 2019 |