Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0162600_circ_g.2 |
| ID in PlantcircBase | osa_circ_036022 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 3695920-3696176 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os08g0162600 |
| Parent gene annotation |
Rubredoxin-type Fe(Cys)4 protein family protein. (Os08t0162600-0 1);Rubredoxin-type Fe(Cys)4 protein family protein. (Os08t016260 0-02);Similar to predicted protein. (Os08t0162600-03) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0162600-01:2 Os08t0162600-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.19794478 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3696147-3695995(-) |
| Potential amino acid sequence |
MYPQSRQMCVALAFCDSVNFRPNLGGAGLFGSRFTSTCAPLFFERLGKEVYVSTIKANVCCSSL L*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |