Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0676000_circ_g.2 |
| ID in PlantcircBase | osa_circ_015963 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 27565152-27566014 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0676000 |
| Parent gene annotation |
Membrane bound O-acyl transferase, MBOAT family protein. (Os02t0 676000-01);Similar to predicted protein. (Os02t0676000-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0676000-01:3 Os02t0676000-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.168244641 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27566000-27565166(+) 27565782-27565166(+) |
| Potential amino acid sequence |
MYWVPDVYERLVQKGKKPGFLQLLGTQTVSAVWHGLYPGYIIFFVQSALMINGSKVIYRWQQAV SNPVFHAILVFVNFSYTLMVLNYSCIGFQMFMRG*(+) MINGSKVIYRWQQAVSNPVFHAILVFVNFSYTLMVLNYSCIGFQMFMRG*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |