Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0180700_circ_g.1 |
ID in PlantcircBase | osa_circ_013490 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 4497418-4497572 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0180700 |
Parent gene annotation |
Similar to Cinnamoyl-CoA reductase (EC 1.2.1.44). (Os02t0180700- 01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0180700-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.304145753 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4497475-4497468(+) 4497543-4497540(-) |
Potential amino acid sequence |
MVSVDLLDRGSLRAAFAGCHGVIHTASPMHDDPMTRRTRTCGRSTARQSG*(+) MTPWQPAKAARRLPRSSRSTLTIVSRSAAPSSAHRCAFFGSSGRRASARRCG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |