Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0658000_circ_g.4 |
| ID in PlantcircBase | osa_circ_025759 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 33560693-33561001 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os04g0658000 |
| Parent gene annotation |
Similar to OSIGBa0132E09-OSIGBa0108L24.1 protein. (Os04t0658000- 01);Similar to Possible apospory-associated like protein. (Os04t 0658000-02) |
| Parent gene strand | + |
| Alternative splicing | Os04g0658000_circ_g.1 Os04g0658000_circ_g.2 Os04g0658000_circ_g.3 Os04g0658000_circ_g.5 Os04g0658000_circ_g.6 |
| Support reads | 3 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0658000-01:1 Os04t0658000-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.27647829 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
33560872-33560947(-) |
| Potential amino acid sequence |
MWVQISEVGKLRKADWYPSTYSFWRFENSLCGQIFRSSSVCVRIKST*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |