Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0658000_circ_g.4 |
ID in PlantcircBase | osa_circ_025759 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 33560693-33561001 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | Os04g0658000 |
Parent gene annotation |
Similar to OSIGBa0132E09-OSIGBa0108L24.1 protein. (Os04t0658000- 01);Similar to Possible apospory-associated like protein. (Os04t 0658000-02) |
Parent gene strand | + |
Alternative splicing | Os04g0658000_circ_g.1 Os04g0658000_circ_g.2 Os04g0658000_circ_g.3 Os04g0658000_circ_g.5 Os04g0658000_circ_g.6 |
Support reads | 3 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os04t0658000-01:1 Os04t0658000-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.27647829 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
33560872-33560947(-) |
Potential amino acid sequence |
MWVQISEVGKLRKADWYPSTYSFWRFENSLCGQIFRSSSVCVRIKST*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |