Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0608300_circ_g.4 |
| ID in PlantcircBase | osa_circ_034707 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 25009463-25010886 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0608300 |
| Parent gene annotation |
Alpha/beta hydrolase fold-1 domain containing protein. (Os07t060 8300-01);Alpha/beta hydrolase fold-1 domain containing protein. (Os07t0608300-02) |
| Parent gene strand | + |
| Alternative splicing | Os07g0608300_circ_g.2 Os07g0608300_circ_g.3 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0608300-02:3 Os07t0608300-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.139151668 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25010768-25009468(+) 25009611-25010878(-) |
| Potential amino acid sequence |
MAGIMLPFLRWFIGGSSSKGPKLLNCVVRSPWSTLDIIAEVW*(+) MIKCSLCIIYDALLRRITITLTIPLQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |