Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.002G266700_circ_g.1 |
| ID in PlantcircBase | gra_circ_000222 |
| Alias | Chr02:62590975|62591099 |
| Organism | Gossypium raimondii |
| Position | chrChr02: 62590975-62591099 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.002G266700 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/13 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.002G266700.2:1 Gorai.002G266700.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.988 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
62591017-62591032(+) 62591078-62591045(+) |
| Potential amino acid sequence |
MFGPFLTQRTKSKFVISREGHAAETLYKFSSMSHGTSVCCTQCSVHF*(+) MLQKHCTNFHQCPMVLQCAVLNVRSIFNSAN*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |