Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d038337_circ_g.1 |
ID in PlantcircBase | zma_circ_009127 |
Alias | zma_circ_0002387 |
Organism | Zea mays |
Position | chr6: 154807322-154808295 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d038337 |
Parent gene annotation |
DAR GTPase 3 chloroplastic |
Parent gene strand | - |
Alternative splicing | Zm00001d038337_circ_g.2 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d038337_T001:3 Zm00001d038337_T002:3 Zm00001d038337_T003:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.164185156 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
154808241-154807334(+) 154808287-154807374(+) 154808297-154808282(-) |
Potential amino acid sequence |
MSLRFKTMILFRLPSHESISALL*(+) MSPFQLSCDTWPRCCWAHSSF*(+) MDSWLGNRKRIIVLNRKDMISTEDMNAWATYFGNQGIKVVFSNGQLGMGTMKLGRMAKSVASVA NTKRKEKGLLPRPVRAGIVGYPNVGKSSLINRLLKRRMCPAAPRPGVTRELKWTHG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |