Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G60100_circ_g.4 |
| ID in PlantcircBase | ath_circ_044924 |
| Alias | At_ciR4196 |
| Organism | Arabidpsis thaliana |
| Position | chr5: 24199985-24200146 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ, CIRI-full |
| Parent gene | AT5G60100 |
| Parent gene annotation |
Pseudo-response regulator 3 |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 4 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT5G60100.5:1 AT5G60100.4:1 AT5G60100.2:1 AT5G60100.6:1 AT5G60100.3:1 AT5G60100.7:1 AT5G60100.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.202176902 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24200061-24199987(-) |
| Potential amino acid sequence |
MPVHSGTGLLSKIMSHKTLKNIPVIITAVPDVLEAWRILEDEKSCIDLVLTEVDMPVHSGTGLL SKIMSHKTLKNIPVIITAVPDVLEAWRILEDEKSCIDLVLTEVDMPVHSGTGLLSKIMSHKTLK NIPVIITAVPDVLEAWRILEDEKSCIDLVLTEVDMPVHSGTGLLSKIMSHKTLKNIPVI(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |