Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0865100_circ_g.1 |
| ID in PlantcircBase | osa_circ_004934 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 37441616-37441991 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0865100 |
| Parent gene annotation |
Similar to Uricase (Fragment). (Os01t0865100-01);Similar to Uric ase. (Os01t0865100-02) |
| Parent gene strand | - |
| Alternative splicing | Os01g0865100_circ_g.2 Os01g0865100_circ_g.3 Os01g0865100_circ_g.4 Os01g0865100_circ_g.5 Os01g0865100_circ_g.6 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0865100-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.277313431 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
37441952-37441685(+) 37441842-37441982(-) |
| Potential amino acid sequence |
MTLMESGKHAQKDTFTNPGFSLFPKLTGIKWRFGILS*(+) MAKEVLNRFPDIASVQLRMPNLHFIPVNLGNKENPGLVKVSF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |