Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0388600_circ_g.1 |
| ID in PlantcircBase | osa_circ_027744 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 18799385-18800551 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0388600 |
| Parent gene annotation |
Protein of unknown function DUF3411 domain containing protein. ( Os05t0388600-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0388600-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | zma_circ_009098* |
| PMCS | 0.240808897 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18799389-18799394(+) 18800519-18799479(+) |
| Potential amino acid sequence |
MAIVADFMLVWLPAPTVSLQPPLAVNAGSIAKFFHNCPDNAFQVALAGTSYSLLQRVGAIMRNG AKLFAVGTSASLIGTGVTNALIKARKAVSKDFEGESEDIPIVSTSVAYGVYMAVSSNLRSWQ*( +) MVYTWPFPVTSGHGNSCRLYVGLASCSNSVSAATTSSKCRIYC*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |