Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0388600_circ_g.1 |
ID in PlantcircBase | osa_circ_027744 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 18799385-18800551 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0388600 |
Parent gene annotation |
Protein of unknown function DUF3411 domain containing protein. ( Os05t0388600-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os05t0388600-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | zma_circ_009098* |
PMCS | 0.240808897 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
18799389-18799394(+) 18800519-18799479(+) |
Potential amino acid sequence |
MAIVADFMLVWLPAPTVSLQPPLAVNAGSIAKFFHNCPDNAFQVALAGTSYSLLQRVGAIMRNG AKLFAVGTSASLIGTGVTNALIKARKAVSKDFEGESEDIPIVSTSVAYGVYMAVSSNLRSWQ*( +) MVYTWPFPVTSGHGNSCRLYVGLASCSNSVSAATTSSKCRIYC*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |