Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G79600_circ_g.1 |
ID in PlantcircBase | ath_circ_011044 |
Alias | At_ciR5134, AT1G79600_C1 |
Organism | Arabidpsis thaliana |
Position | chr1: 29951881-29952108 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, circRNA_finder, find_circ, CIRI-full, CIRI2 |
Parent gene | AT1G79600 |
Parent gene annotation |
ABC1K3 |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2/21 |
Tissues | leaf/inflorescences, whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G79600.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.361603948 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
29952016-29951883(-) |
Potential amino acid sequence |
MKKRAIELRRIFTRLGPTFVKLGQGLSTRPDLCPPDYLEELAELQALRRSLEILGALGGFALKL GIDQKQGNLEKNMKKRAIELRRIFTRLGPTFVKLGQGLSTRPDLCPPDYLEELAELQALRRSLE ILGALGGFALKLGIDQKQGNLEKNMKKRAIELRRIFTRLGPTFVKLGQGLSTRPDLCPPDYLEE LAELQALRRSLEILGALGGFALKLGIDQKQGNLEKNMKKRAIELRRIFTRLGPTFVKLGQGLST RPDLCPPDYLEELAELQ(-) |
Sponge-miRNAs | ath-miR5021 |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017;Zhang et al., 2019 |