Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G79600_circ_g.1 |
| ID in PlantcircBase | ath_circ_011044 |
| Alias | At_ciR5134, AT1G79600_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 29951881-29952108 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, circRNA_finder, find_circ, CIRI-full, CIRI2 |
| Parent gene | AT1G79600 |
| Parent gene annotation |
ABC1K3 |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2/21 |
| Tissues | leaf/inflorescences, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G79600.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.361603948 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29952016-29951883(-) |
| Potential amino acid sequence |
MKKRAIELRRIFTRLGPTFVKLGQGLSTRPDLCPPDYLEELAELQALRRSLEILGALGGFALKL GIDQKQGNLEKNMKKRAIELRRIFTRLGPTFVKLGQGLSTRPDLCPPDYLEELAELQALRRSLE ILGALGGFALKLGIDQKQGNLEKNMKKRAIELRRIFTRLGPTFVKLGQGLSTRPDLCPPDYLEE LAELQALRRSLEILGALGGFALKLGIDQKQGNLEKNMKKRAIELRRIFTRLGPTFVKLGQGLST RPDLCPPDYLEELAELQ(-) |
| Sponge-miRNAs | ath-miR5021 |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017;Zhang et al., 2019 |