Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0110100_circ_g.1 |
ID in PlantcircBase | osa_circ_010299 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 556892-558070 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os12g0110100 |
Parent gene annotation |
Esterase/lipase/thioesterase domain containing protein. (Os12t01 10100-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os12t0110100-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.208445858 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
558041-556944(+) 558061-558054(-) |
Potential amino acid sequence |
MVGSLSMSGCTHSIKNFQESGSSVLSWR*(+) MDKEPTMEDLPSTLGQPSTSASSVDARYSADRTEDSQLFLSVPALNQAASYLAQTASYLTQCLP VSGYTAISEEGQELATLPPASTVGGSSFQASSEQSADSSPGEIDNTGSSSQEITEQMAPLRVFQ NGASLFQGLVERARKTVRGSANDIGWLQQDQSLPPTEDGTARFLEILDAVSTTAHG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |