Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G30390_circ_g.2 |
ID in PlantcircBase | ath_circ_015639 |
Alias | At_ciR2465 |
Organism | Arabidpsis thaliana |
Position | chr2: 12952012-12952164 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | find_circ, CIRI-full |
Parent gene | AT2G30390 |
Parent gene annotation |
Ferrochelatase |
Parent gene strand | - |
Alternative splicing | AT2G30390_circ_g.3 AT2G30390_circ_g.4 |
Support reads | 3 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT2G30390.1:1 AT2G30390.2:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.334420923 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
12952090-12952014(-) |
Potential amino acid sequence |
MEECVDLIMEELDKRKITNAYTLAYQVVIFFSAHGVPLAYVEEAGDPYKAEMEECVDLIMEELD KRKITNAYTLAYQVVIFFSAHGVPLAYVEEAGDPYKAEMEECVDLIMEELDKRKITNAYTLAYQ VVIFFSAHGVPLAYVEEAGDPYKAEMEECVDLIMEELDKRKITNAYTLAYQ(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |