Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0795200_circ_g.1 |
ID in PlantcircBase | osa_circ_004430 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 33684965-33685721 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0795200 |
Parent gene annotation |
Similar to Subtilase. (Os01t0795200-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0795200-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.125506968 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
33685035-33684984(+) 33684974-33685612(-) |
Potential amino acid sequence |
MLSSIIGSKEEAKASITYSYKHGFSGFAAMLTEDQAEDLAELPEVISITPNQKHELMTTRSWDF LGLKNEPPSEFLQRSNYGEDIIIGIIDTVVHRLPW*(+) MYNSVNYPNNYVFSIVAPLQKLTGWFIFKPEEIPASGGH*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |