Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G78610_circ_g.3 |
| ID in PlantcircBase | ath_circ_010791 |
| Alias | At_ciR848, Ath_circ_FC1067, AT1G78610_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 29569899-29570192 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, circRNA_finder, find_circ, CIRI-full, CIRI2 |
| Parent gene | AT1G78610 |
| Parent gene annotation |
Mechanosensitive ion channel protein 6 |
| Parent gene strand | - |
| Alternative splicing | AT1G78610_circ_g.1 AT1G78610_circ_g.2 |
| Support reads | 8/16/17 |
| Tissues | leaf/root, whole_plant/seedlings |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G78610.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.582726833 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29570115-29569901(-) |
| Potential amino acid sequence |
MVNIVVGIIILVIWLIILGITSTKFLVVMSSQVVVVAFIFGNMCKIVFESIIYLFVIHPFDVGD RCEIDGVQVNAFRERRALALTLNDTKTAVNRLHKMVNIVVGIIILVIWLIILGITSTKFLVVMS SQVVVVAFIFGNMCKIVFESIIYLFVIHPFDVGDRCEIDGVQVNAFRERRALALTLNDTKTAVN RLHKMVNIVVGIIILVIWLIILGITSTKFLVVMSSQVVVVAFIFGNMCKIVFESIIYLFVIHPF DVGDRCEIDGVQVNAFRERRALALTLNDTKTAVNRLHKMVNIVVGIIILVIWLIILGITSTKFL VVMSSQVVVVAFIFGNMCKIVFESIIYLFVIHPFDVGDRCEIDGVQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress; responsive to heat stress |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017;Pan et al., 2017;Chen et al., 2017a;Zhang et al., 2019 |