Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G78610_circ_g.3 |
ID in PlantcircBase | ath_circ_010791 |
Alias | At_ciR848, Ath_circ_FC1067, AT1G78610_C1 |
Organism | Arabidpsis thaliana |
Position | chr1: 29569899-29570192 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, circRNA_finder, find_circ, CIRI-full, CIRI2 |
Parent gene | AT1G78610 |
Parent gene annotation |
Mechanosensitive ion channel protein 6 |
Parent gene strand | - |
Alternative splicing | AT1G78610_circ_g.1 AT1G78610_circ_g.2 |
Support reads | 8/16/17 |
Tissues | leaf/root, whole_plant/seedlings |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G78610.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.582726833 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
29570115-29569901(-) |
Potential amino acid sequence |
MVNIVVGIIILVIWLIILGITSTKFLVVMSSQVVVVAFIFGNMCKIVFESIIYLFVIHPFDVGD RCEIDGVQVNAFRERRALALTLNDTKTAVNRLHKMVNIVVGIIILVIWLIILGITSTKFLVVMS SQVVVVAFIFGNMCKIVFESIIYLFVIHPFDVGDRCEIDGVQVNAFRERRALALTLNDTKTAVN RLHKMVNIVVGIIILVIWLIILGITSTKFLVVMSSQVVVVAFIFGNMCKIVFESIIYLFVIHPF DVGDRCEIDGVQVNAFRERRALALTLNDTKTAVNRLHKMVNIVVGIIILVIWLIILGITSTKFL VVMSSQVVVVAFIFGNMCKIVFESIIYLFVIHPFDVGDRCEIDGVQ(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress; responsive to heat stress |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017;Pan et al., 2017;Chen et al., 2017a;Zhang et al., 2019 |