Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0564800_circ_g.1 |
| ID in PlantcircBase | osa_circ_034328 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 22648977-22649166 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0564800 |
| Parent gene annotation |
Protein of unknown function DUF707 family protein. (Os07t0564800 -01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0564800-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.110526316 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22649159-22649163(+) 22649108-22648979(-) |
| Potential amino acid sequence |
MGSLCPHIKACLHSHLLLRFCSFLVKWIIVFAMGSLCPHIKACLHSHLLLRFCSFLVKWIIVFA MGSLCPHIKACLHSHLLLRFCSFLVKWIIVFAMGS(+) MRVKAGLDMRTKRSHGKNNDPLHQKTAEAQQQMRVKAGLDMRTKRSHGKNNDPLHQKTAEAQQQ MRVKAGLDMRTKRSHGKNNDPLHQKTAEAQQQMRVKAGLDMRTK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |