Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G28220_circ_g.2 |
ID in PlantcircBase | ath_circ_033296 |
Alias | Ath_circ_FC5735 |
Organism | Arabidpsis thaliana |
Position | chr4: 13993773-13993979 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT4G28220 |
Parent gene annotation |
External alternative NAD(P)H-ubiquinone oxidoreductase B1, mitoc hondrial |
Parent gene strand | + |
Alternative splicing | AT4G28220_circ_g.1 AT4G28220_circ_g.3 AT4G28220_circ_g.4 |
Support reads | 2 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT4G28220.2:1 AT4G28220.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.169987923 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
13993971-13993775(-) |
Potential amino acid sequence |
MAILKYTRSAKCVNLSSHCYDQVVISKGKFLACFRIILENWSTVNLLINMINLKTICFPQFNFP IFLEKMAILKYTRSAKCVNLSSHCYDQVVISKGKFLACFRIILENWSTVNLLINMINLKTICFP QFNFPIFLEKMAILKYTRSAKCVNLSSHCYDQVVISKGKFLACFRIILENWSTVNLLINMINLK TICFPQFNFPIFLEKMAILKYTRSAKCVNLSSHCYDQVVISKGKFLACFRIILENWSTVNLLIN MINLKTICFPQFNFPIF(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017;Chen et al., 2017a |