Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0198333_circ_g.1 |
ID in PlantcircBase | osa_circ_013669 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 5506444-5507638 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0198333 |
Parent gene annotation |
Hypothetical gene. (Os02t0198333-00) |
Parent gene strand | - |
Alternative splicing | Os02g0198333_circ_g.2 Os02g0198333_circ_g.3 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0198300-01:5 Os02t0198300-02:5 Os02t0198300-01:5 Os02t0198300-02:5 Os02t0198333-00:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.218760251 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5507290-5506449(+) 5506469-5507360(-) |
Potential amino acid sequence |
MIEFIGILNVKVKGGTNLAIRDMSSSDPYVVLTLGQQKAQTSVIKANLNPVWNEELKLSVPQQY GPLKLIS*(+) MNTPILADQFERAVLLRNRELEFFVPDRVQVGFDHRGLRFLLPKGQDYIRITA*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |