Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0662850_circ_g.2 |
| ID in PlantcircBase | osa_circ_025815 |
| Alias | Os_ciR9662 |
| Organism | Oryza sativa |
| Position | chr4: 33824355-33824641 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os04g0662800 |
| Parent gene annotation |
Regulator of chromosome condensation, RCC1 domain containing pro tein. (Os04t0662800-01) |
| Parent gene strand | + |
| Alternative splicing | Os04g0662850_circ_g.1 Os04g0662850_circ_g.3 Os04g0662850_circ_g.4 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0662850-00:1 Os04t0662800-01:2 Os04t0662850-00:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.290816115 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
33824401-33824358(+) 33824373-33824358(+) 33824368-33824440(-) |
| Potential amino acid sequence |
MLFVVLILLSGCHQWRALLYLQQVFPSTVSLVMEPTMRN*(+) MPCLVTEATNAVCGADFTVWLSSVEGSTILTAGLPQYGQLGHGTDNEKLRHHQCPVLLLKQLML FVVLILLSGCHQWRALLYLQQVFPSTVSLVMEPTMRN*(+) MSQFLIVGSMTKLTVLGKTCCKYSRALH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |