Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0662850_circ_g.2 |
ID in PlantcircBase | osa_circ_025815 |
Alias | Os_ciR9662 |
Organism | Oryza sativa |
Position | chr4: 33824355-33824641 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os04g0662800 |
Parent gene annotation |
Regulator of chromosome condensation, RCC1 domain containing pro tein. (Os04t0662800-01) |
Parent gene strand | + |
Alternative splicing | Os04g0662850_circ_g.1 Os04g0662850_circ_g.3 Os04g0662850_circ_g.4 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os04t0662850-00:1 Os04t0662800-01:2 Os04t0662850-00:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.290816115 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
33824401-33824358(+) 33824373-33824358(+) 33824368-33824440(-) |
Potential amino acid sequence |
MLFVVLILLSGCHQWRALLYLQQVFPSTVSLVMEPTMRN*(+) MPCLVTEATNAVCGADFTVWLSSVEGSTILTAGLPQYGQLGHGTDNEKLRHHQCPVLLLKQLML FVVLILLSGCHQWRALLYLQQVFPSTVSLVMEPTMRN*(+) MSQFLIVGSMTKLTVLGKTCCKYSRALH*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |