Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0545300_circ_g.4 |
| ID in PlantcircBase | osa_circ_009549 |
| Alias | Os_ciR2492 |
| Organism | Oryza sativa |
| Position | chr11: 20071634-20071794 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os11g0545300 |
| Parent gene annotation |
Similar to Topoisomerase 6 subunit A-like protein. (Os11t0545300 -01);Hypothetical gene. (Os11t0545300-02) |
| Parent gene strand | + |
| Alternative splicing | Os11g0545300_circ_g.5 Os11g0545300_circ_g.6 |
| Support reads | 12/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os11t0545300-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.228240166 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20071653-20071685(+) |
| Potential amino acid sequence |
MLSNSEEDFTLLMFNIPHREQVVAATLEDCLDHIVEENVHDSLSRCERFVPNVECFLILKKILL C*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |