Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0772600_circ_g.3 |
ID in PlantcircBase | osa_circ_004105 |
Alias | Os_ciR6158 |
Organism | Oryza sativa |
Position | chr1: 32618686-32619680 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os01g0772600 |
Parent gene annotation |
Similar to Casein kinase-like protein. (Os01t0772600-01);Similar to Casein kinase-like protein. (Os01t0772600-02);Similar to ATP binding protein. (Os01t0772600-03) |
Parent gene strand | + |
Alternative splicing | Os01g0772600_circ_g.4 Os01g0772600_circ_g.5 Os01g0772600_circ_g.6 Os01g0772600_circ_g.7 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0772600-02:6 Os01t0772600-01:6 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.209827714 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
32618834-32618849(+) |
Potential amino acid sequence |
MDILGPSLWDVWNSVGQTMTPSMVACIAVEAISILEKLHAKGFVHGDVKPENFLLGQPGSPDEK KLFLIDLGLASKWKETPNGQHVDYDQRPDIFRGTIRYASVHAHLGRTGSRRDDLESLAYTLIFL LRGRLPWQGYQCSEWMLWYTLGSLQRPAGGLLCSGNGHTRT*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |