Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0629300_circ_g.2 |
| ID in PlantcircBase | osa_circ_025470 |
| Alias | Os_ciR9590 |
| Organism | Oryza sativa |
| Position | chr4: 32014075-32015463 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | Os04g0629300 |
| Parent gene annotation |
Similar to H0303G06.18 protein. (Os04t0629300-01);DEAD-like heli case, N-terminal domain containing protein. (Os04t0629300-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0629300-02:4 Os04t0629300-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.102593856 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
32015316-32015409(-) |
| Potential amino acid sequence |
MDIIDLCSDSEEYFSPYSDTEDNLDFDDPNDGVNQVVLHNTAFGNNSSELLVGLDDDNWLNNTH ALSSHRPAENRSDIIESSSGVNTDCQNSAWQYRTLPHTFMSSSYKSRPLSLTGGNNVESTHPTV KPNTVHYNGIGFPSPAIASGYKPYVSYGQGVSIDDDDDDVYEVLHQPFPFSHSSLGDKKIEEES TWKYNGFQTSSAYGIEMPTSAMSTGGVSAYGGLNSHRIFPPSVPYNNSVNNFGVNGLGTQSHLN IEKRLFGRDERVVYDEALKQISQETTEENLPEGVMSVSLLKHQKIVFKWVHQDNLFAVCWR*(- ) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |