Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0525400_circ_g.1 |
| ID in PlantcircBase | osa_circ_014850 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 19193257-19196007 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0525400 |
| Parent gene annotation |
Similar to Molybdenum cofactor synthesis protein 3 (Molybdopteri n synthase sulfurylase) (MPT synthase sulfurylase). (Os02t052540 0-01) |
| Parent gene strand | + |
| Alternative splicing | Os02g0525400_circ_g.2 Os02g0525400_circ_g.3 Os02g0525400_circ_g.4 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0525400-01:8 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.10580983 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19195021-19193553(+) 19195953-19193272(+) |
| Potential amino acid sequence |
MLLFDALSARIRIVKIRGSSTVCTVCGENSAFTQDDFQKFDYENFTQSPMSDKVAWALLMEMML SLITFTDR*(+) MIFRSLIMRTSRSLQCLIRLLGHC*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |