Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0525400_circ_g.1 |
ID in PlantcircBase | osa_circ_014850 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 19193257-19196007 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0525400 |
Parent gene annotation |
Similar to Molybdenum cofactor synthesis protein 3 (Molybdopteri n synthase sulfurylase) (MPT synthase sulfurylase). (Os02t052540 0-01) |
Parent gene strand | + |
Alternative splicing | Os02g0525400_circ_g.2 Os02g0525400_circ_g.3 Os02g0525400_circ_g.4 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0525400-01:8 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.10580983 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
19195021-19193553(+) 19195953-19193272(+) |
Potential amino acid sequence |
MLLFDALSARIRIVKIRGSSTVCTVCGENSAFTQDDFQKFDYENFTQSPMSDKVAWALLMEMML SLITFTDR*(+) MIFRSLIMRTSRSLQCLIRLLGHC*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |