Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | LOC18046346_circ_g.1 |
| ID in PlantcircBase | ptr_circ_000194 |
| Alias | circRNA194 |
| Organism | Poncirus trifoliata |
| Position | chrNW_006262339.1: 43864686-43865173 JBrowse» |
| Reference genome | Citrus_clementina_v1.0 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | LOC18046346 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | shoots |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | XM_006443860.2:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
43864905-43865170(-) 43864715-43865170(-) 43865125-43864720(+) |
| Potential amino acid sequence |
MSSYDSESNFMTAGKKYANSSGNNMGSTEELWQAFFASPNEWWDNRKNKD*(-) MSGGIIGKTRINLTFWDELAHVASQHVEKGQQIYISGRLVSDVVESDDGQQQTYYKVVVQQLNF VERSSPSMSSYDSESNFMTAGKKYANSSGNNMGSTEELWQAFFASPNEWWDNRKNKD*(-) MLRCNMCQLIPEGQINPCFSYYPTTHLD*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | playing an important role in the early flowering process |
| Other Information | |
|---|---|
| References | Zeng et al., 2018 |