Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0711000_circ_g.1 |
ID in PlantcircBase | osa_circ_016228 |
Alias | Os02circ24102 |
Organism | Oryza sativa |
Position | chr2: 29458799-29459094 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | SMALT, Segemehl |
Parent gene | Os02g0711000 |
Parent gene annotation |
Conserved hypothetical protein. (Os02t0711000-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0711000-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.139078716 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
29459041-29458812(+) 29459077-29459046(-) |
Potential amino acid sequence |
MPIFLHLQNLLHPSIITRYCSSP*(+) MQQILQMEKDRHAEFLRQYNREQDYLGDPKGVTVQILSRSLEGKLTICRCLFMEKSNIWLLWKD ATNSADGER*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015 |