Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0711000_circ_g.1 |
| ID in PlantcircBase | osa_circ_016228 |
| Alias | Os02circ24102 |
| Organism | Oryza sativa |
| Position | chr2: 29458799-29459094 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | SMALT, Segemehl |
| Parent gene | Os02g0711000 |
| Parent gene annotation |
Conserved hypothetical protein. (Os02t0711000-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0711000-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.139078716 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29459041-29458812(+) 29459077-29459046(-) |
| Potential amino acid sequence |
MPIFLHLQNLLHPSIITRYCSSP*(+) MQQILQMEKDRHAEFLRQYNREQDYLGDPKGVTVQILSRSLEGKLTICRCLFMEKSNIWLLWKD ATNSADGER*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015 |