Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0533700_circ_g.1 |
| ID in PlantcircBase | osa_circ_037827 |
| Alias | Os_ciR11584 |
| Organism | Oryza sativa |
| Position | chr8: 26608541-26608837 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os08g0533700 |
| Parent gene annotation |
Similar to cation cation antiporter. (Os08t0533700-01) |
| Parent gene strand | + |
| Alternative splicing | Os08g0533700_circ_ag.1 Os08g0533700_circ_ag.2 Os08g0533700_circ_ag.3 Os08g0533700_circ_ag.4 Os08g0533700_circ_ag.5 Os08g0533700_circ_ag.6 Os08g0533700_circ_ag.7 Os08g0534200_circ_ag.1 Os08g0534350_circ_g.1 Os08g0534350_circ_ag.1 Os08g0534350_circ_ag.2 Os08g0534900_circ_ag.1 |
| Support reads | 2/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0533700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.414534784 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26608745-26608548(+) 26608630-26608636(-) |
| Potential amino acid sequence |
MLDLAVMRERIETLEHLLNWMQKRRLTLRSIARK*(+) MIMILDFLAFLLHKSFLPLYSHQLALHFLAMLLNVSLRFCIQFNRCSNVSILSRMTARSNIGVS YWSPT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |