Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0503500_circ_g.4 |
| ID in PlantcircBase | osa_circ_007578 |
| Alias | Os_ciR4570 |
| Organism | Oryza sativa |
| Position | chr10: 19221683-19222557 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | find_circ |
| Parent gene | Os10g0503500 |
| Parent gene annotation |
Similar to NAD-dependent malic enzyme 59 kDa isoform, mitochondr ial precursor (EC 1.1.1.39) (NAD-ME). (Os10t0503500-01);Similar to Malic enzyme. (Os10t0503500-02);Similar to Malic enzyme. (Os1 0t0503500-03) |
| Parent gene strand | + |
| Alternative splicing | Os10g0503500_circ_g.5 |
| Support reads | 4 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os10t0503500-03:2 Os10t0503500-01:3 Os10t0503500-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.144238229 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19222331-19221738(+) |
| Potential amino acid sequence |
MKESDSPRPAIFAMSNPTTKAECTPEDVFKYVGDNAVFASGSPFSNVTLGQESEASCAFRTFWS WGHI*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |