Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0665700_circ_g.5 |
ID in PlantcircBase | osa_circ_035203 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 28102829-28103105 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os07g0665700 |
Parent gene annotation |
Peptidase, trypsin-like serine and cysteine domain containing pr otein. (Os07t0665700-01) |
Parent gene strand | - |
Alternative splicing | Os07g0665250_circ_ag.1 Os07g0665300_circ_ag.1 Os07g0665700_circ_igg.1 Os07g0665700_circ_g.1 Os07g0665700_circ_g.2 Os07g0665700_circ_g.3 Os07g0665700_circ_g.4 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os07t0665750-00:1 Os07t0665750-00:1 Os07t0665700-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.14410352 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
28102920-28103090(-) 28102945-28102831(-) |
Potential amino acid sequence |
MNLLMISGVNSPKKLLQTCLVLLSLLLHSMNLGNF*(-) MRLVNTFENEFADDIWSKLTKKVASNMSRVVVSLASFNEFGKFLIKELTSQGYPLPAVLDGGMR LVNTFENEFADDIWSKLTKKVASNMSRVVVSLASFNEFGKFLIKELTSQGYPLPAVLDGGMRLV NTFENEFADDIWSKLTKKVASNMSRVVVSLASFNEFGKFLIKELTSQGYPLPAVLDGGMRLVNT FENEFADDIWSKLTKKVASNMSRVVVSLASFN(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |