Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0810400_circ_g.7 |
| ID in PlantcircBase | osa_circ_017104 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 34647457-34647762 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
| Parent gene | Os02g0810400 |
| Parent gene annotation |
Similar to Dual specificity kinase 1. (Os02t0810400-01) |
| Parent gene strand | + |
| Alternative splicing | Os02g0810400_circ_g.8 Os02g0810400_circ_g.9 |
| Support reads | 7 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0810400-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.404544308 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34647525-34647473(+) |
| Potential amino acid sequence |
MLTPVEVLCKSYPSEFISYFHYCRSLRFEDKPDYSYLKRLFRDLFIREAYHGRG*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |