Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G79750_circ_g.11 |
ID in PlantcircBase | ath_circ_011089 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 30009369-30009618 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT1G79750 |
Parent gene annotation |
Malic enzyme |
Parent gene strand | - |
Alternative splicing | AT1G79750_circ_g.1 AT1G79750_circ_g.2 AT1G79750_circ_g.3 AT1G79750_circ_g.4 AT1G79750_circ_g.5 AT1G79750_circ_g.6 AT1G79750_circ_g.7 AT1G79750_circ_g.8 AT1G79750_circ_g.9 AT1G79750_circ_g.10 AT1G79750_circ_g.12 AT1G79750_circ_g.13 AT1G79750_circ_g.14 |
Support reads | 8 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G79750.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.353817333 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
30009604-30009371(-) |
Potential amino acid sequence |
MHEFMTAVKQNYGEKVVIQFEDFANHNAFDLLAKYGTTHLVFNDDIQEYSELMHEFMTAVKQNY GEKVVIQFEDFANHNAFDLLAKYGTTHLVFNDDIQEYSELMHEFMTAVKQNYGEKVVIQFEDFA NHNAFDLLAKYGTTHLVFNDDIQEYSELMHEFMTAVKQNYGEKVVIQFEDFANHNAFDLLAKYG TTHLVFNDDIQ(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |