Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0337900_circ_g.7 |
| ID in PlantcircBase | osa_circ_019709 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 12549385-12550804 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0337900 |
| Parent gene annotation |
Similar to predicted protein. (Os03t0337900-01) |
| Parent gene strand | - |
| Alternative splicing | Os03g0337900_circ_g.2 Os03g0337900_circ_g.3 Os03g0337900_circ_g.4 Os03g0337900_circ_g.5 Os03g0337900_circ_g.6 Os03g0337900_circ_g.8 Os03g0337900_circ_g.9 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0337900-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.128985587 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12550734-12549426(+) 12550607-12550731(-) |
| Potential amino acid sequence |
MIIRVYKLLATLMSKNLSGPICNNPFLVFKPVPTAVPP*(+) MHIAAATEINSRFVPSLQQLHKSLDSKSVEFQDIIKIGRTHTQDATPLTLGQEFSGYATQVKYG IDRIVCTLPRMYQLAQGGTAVGTGLNTKKGLLQIGPLRFLDISVARSLYTLMIM*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |