Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | BGIOSGA007484_circ_g.6 |
| ID in PlantcircBase | osi_circ_003643 |
| Alias | 2:2157369|2159721 |
| Organism | Oryza sativa ssp. indica |
| Position | chr2: 2157369-2159721 JBrowse» |
| Reference genome | Oryza_indica.ASM465v1.42 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | BGIOSGA007484 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | BGIOSGA007484_circ_g.1 BGIOSGA007484_circ_g.2 BGIOSGA007484_circ_g.3 BGIOSGA007484_circ_g.4 BGIOSGA007484_circ_g.5 BGIOSGA007484_circ_g.7 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | BGIOSGA007484-TA:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2157373-2157376(+) |
| Potential amino acid sequence |
MGDRSGNIRWWDVTTGLSSSFSTHREGIRRIKFSPVVHGDRSRGRIAVLFYDNTFSIFDLDSAD PLANALLQPQSPGTLVLELDWLSTRTXKDEPLVLCIAGADSSFRLIEVNIDPRASSTLRPVTTR ERFRPMPLCLPILFPTAHALALRMILQLGVKPSWFECNSGDKLASSSFKEAPATFGDLRSYMIE TTLPPIGDSVVAELLLKVLEPYRKDGDG*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Huang et al., 2021 |