Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0266100_circ_g.3 |
| ID in PlantcircBase | osa_circ_019033 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 8798994-8799083 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os03g0266100 |
| Parent gene annotation |
Zinc finger, LIM-type domain containing protein. (Os03t0266100-0 1) |
| Parent gene strand | + |
| Alternative splicing | Os03g0266100_circ_g.2 |
| Support reads | 3 |
| Tissues | pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0266100-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.172218519 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8799022-8799080(+) 8799024-8798996(-) |
| Potential amino acid sequence |
MFSGTQEKCATCSKTAYPLEKTRSPSKAARMFSGTQEKCATCSKTAYPLEKTRSPSKAARMFSG TQEKCATCSKTAYPLEKTRSPSKAARMFSGTQEKCATCSKTAYPLEK(+) MRAALLGDLVFSRGYAVLLQVAHFSCVPENMRAALLGDLVFSRGYAVLLQVAHFSCVPENMRAA LLGDLVFSRGYAVLLQVAHFSCVPENMRAALLGDL(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |