Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0144600_circ_g.2 |
ID in PlantcircBase | osa_circ_029661 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 2359329-2360808 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os06g0144600 |
Parent gene annotation |
Similar to Zinc carboxy peptidase. (Os06t0144600-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os06t0144600-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_006525 osi_circ_016423 |
PMCS | 0.237005687 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2360760-2359371(+) |
Potential amino acid sequence |
MPCTGMSYHQDIHNTVCSEPIPFIVREPGIG*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |