Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G19480_circ_g.3 |
| ID in PlantcircBase | ath_circ_013817 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr2: 8439248-8439340 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT2G19480 |
| Parent gene annotation |
Nucleosome assembly protein 1;2 |
| Parent gene strand | + |
| Alternative splicing | AT2G19480_circ_g.1 AT2G19480_circ_g.2 AT2G19480_circ_g.4 |
| Support reads | 2 |
| Tissues | leaf, aerial, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT2G19480.1:1 AT2G19480.3:1 AT2G19480.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.2796681 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8439263-8439337(+) 8439255-8439337(+) |
| Potential amino acid sequence |
MEAKFFEERAALEAKYQKLYQPLYTKNQYDEMEAKFFEERAALEAKYQKLYQPLYTKNQYDEME AKFFEERAALEAKYQKLYQPLYTKNQYDEMEAKFFEERAALEAKYQKLYQPLYTK(+) MMRWKQNSLRREQLLKLSIKSYISLYIPRTNMMRWKQNSLRREQLLKLSIKSYISLYIPRTNMM RWKQNSLRREQLLKLSIKSYISLYIPRTNMMRWKQNSLRREQLLKLSIKSYISLYIP(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |