Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0576600_circ_g.1 |
ID in PlantcircBase | osa_circ_012095 |
Alias | Os_ciR7436 |
Organism | Oryza sativa |
Position | chr12: 23808310-23808681 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | find_circ |
Parent gene | Os12g0576600 |
Parent gene annotation |
Metallophosphoesterase domain containing protein. (Os12t0576600- 01);Metallophosphoesterase domain containing protein. (Os12t0576 600-02) |
Parent gene strand | - |
Alternative splicing | Os12g0576600_circ_ag.1 Os12g0576600_circ_ag.2 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os12t0576600-01:2 Os12t0576600-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.423468731 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23808364-23808310(+) 23808666-23808605(-) |
Potential amino acid sequence |
MEELYLYPFTVLTLQSKNPRRCLDMRRFVDGKDRPLDSDPRQRLLTGVRRRADNQPCGHHPKPD HTPPSVS*(+) MIRLWVVATWLIVCAAAHPGEQPLSRIAVERTVLAVNESAHVKASPWVLGLKGQNSEWVEVEFF HPSPSNDDWIGVFSPANFRTLKEEYDQALGGGHMADCLRGGAPR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |