Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0576600_circ_g.1 |
| ID in PlantcircBase | osa_circ_012095 |
| Alias | Os_ciR7436 |
| Organism | Oryza sativa |
| Position | chr12: 23808310-23808681 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | Os12g0576600 |
| Parent gene annotation |
Metallophosphoesterase domain containing protein. (Os12t0576600- 01);Metallophosphoesterase domain containing protein. (Os12t0576 600-02) |
| Parent gene strand | - |
| Alternative splicing | Os12g0576600_circ_ag.1 Os12g0576600_circ_ag.2 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0576600-01:2 Os12t0576600-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.423468731 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23808364-23808310(+) 23808666-23808605(-) |
| Potential amino acid sequence |
MEELYLYPFTVLTLQSKNPRRCLDMRRFVDGKDRPLDSDPRQRLLTGVRRRADNQPCGHHPKPD HTPPSVS*(+) MIRLWVVATWLIVCAAAHPGEQPLSRIAVERTVLAVNESAHVKASPWVLGLKGQNSEWVEVEFF HPSPSNDDWIGVFSPANFRTLKEEYDQALGGGHMADCLRGGAPR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |