Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0433500_circ_g.9 |
| ID in PlantcircBase | osa_circ_011392 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 14035158-14035898 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os12g0433500 |
| Parent gene annotation |
Similar to FU (FUSED); protein serine/threonine kinase. (Os12t04 33500-01) |
| Parent gene strand | - |
| Alternative splicing | Os12g0433500_circ_g.1 Os12g0433500_circ_g.2 Os12g0433500_circ_g.3 Os12g0433500_circ_g.4 Os12g0433500_circ_g.5 Os12g0433500_circ_g.6 Os12g0433500_circ_g.7 Os12g0433500_circ_g.8 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0433500-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.158019849 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14035700-14035163(+) 14035694-14035887(-) |
| Potential amino acid sequence |
MDNTIGVQVMQCLNQLLSNCLNLFFWKALIILKHLKQLSLL*(+) MKPQNILIGKGSVVKLCDFGFARAMSANTVVLRSIKGRAV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |