Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0698100_circ_g.2 |
| ID in PlantcircBase | osa_circ_003501 |
| Alias | Os_ciR6044 |
| Organism | Oryza sativa |
| Position | chr1: 28886932-28887074 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os01g0698100 |
| Parent gene annotation |
SWAP/Surp domain containing protein. (Os01t0698100-01);Similar t o SWAP (Suppressor-of-White-APricot)/surp domain-containing prot ein. (Os01t0698100-02) |
| Parent gene strand | + |
| Alternative splicing | Os01g0698100_circ_g.1 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0698100-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.236200466 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28887041-28887002(-) |
| Potential amino acid sequence |
MGNNMCSNYLDHLNQQYSHMRKGQNYNQPNLYLSHFQLIQQSVRHGKRWAIICAQIIWII*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |