Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0698100_circ_g.2 |
ID in PlantcircBase | osa_circ_003501 |
Alias | Os_ciR6044 |
Organism | Oryza sativa |
Position | chr1: 28886932-28887074 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os01g0698100 |
Parent gene annotation |
SWAP/Surp domain containing protein. (Os01t0698100-01);Similar t o SWAP (Suppressor-of-White-APricot)/surp domain-containing prot ein. (Os01t0698100-02) |
Parent gene strand | + |
Alternative splicing | Os01g0698100_circ_g.1 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0698100-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.236200466 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
28887041-28887002(-) |
Potential amino acid sequence |
MGNNMCSNYLDHLNQQYSHMRKGQNYNQPNLYLSHFQLIQQSVRHGKRWAIICAQIIWII*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |