Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0400100_circ_g.3 |
| ID in PlantcircBase | osa_circ_006743 |
| Alias | Os_ciR2510 |
| Organism | Oryza sativa |
| Position | chr10: 13493678-13493831 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os10g0400100 |
| Parent gene annotation |
Methionyl-tRNA synthetase, class Ia domain containing protein. ( Os10t0400100-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 8/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os10t0400100-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.3279 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13493824-13493737(+) 13493684-13493737(+) 13493781-13493813(-) |
| Potential amino acid sequence |
MQQVPCHPQGSVRVVRHQLRHLR*(+) MPSTRKCTSGSTSASTSSVEHRRRNRPRSAKTSSSSYWTTIGCQRTQCSRYHAIHKEVYEWFDI SFDIFGRTSSPQQTEVCQDIFLKLLDNNWLSENTMQQVPCHPQGSVRVVRHQLRHLR*(+) MSWQTSVCCGDDVLPKMSKLMSNHSYTSLWMAWYLLHCVL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |