Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G27900_circ_g.12 |
ID in PlantcircBase | ath_circ_015257 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr2: 11884026-11884088 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRI, PcircRNA_finder |
Parent gene | AT2G27900 |
Parent gene annotation |
At2g27890 |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 3 |
Tissues | leaf, aerial, whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT2G27900.2:1 AT2G27900.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.144181215 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11884075-11884085(+) |
Potential amino acid sequence |
MEHNGYVDRIANSKWEIKELGMEHNGYVDRIANSKWEIKELGMEHNGYVDRIANSKWEIKELGM EHN(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |