Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0553300_circ_g.1 |
| ID in PlantcircBase | osa_circ_040151 |
| Alias | Os_ciR3238 |
| Organism | Oryza sativa |
| Position | chr9: 21923668-21924735 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os09g0553300 |
| Parent gene annotation |
NUDIX hydrolase domain containing protein. (Os09t0553300-01) |
| Parent gene strand | - |
| Alternative splicing | Os09g0553300_circ_g.2 |
| Support reads | 4/1 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0553300-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_018752 |
| PMCS | 0.206847878 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21924134-21923867(+) 21923839-21924111(-) |
| Potential amino acid sequence |
MFPGRLLPLQTLQPPNNQQEESKGHKLVRSFFCKGVLCYHVPQDSQQPFVYSAVVEFDISGLDI FKIHPQGDNDRRKC*(+) MYLEDVKSGNIKFHYCTINKRLLAVLWNMITKYSFAEERSNQLMAFGLFLLVIWRLESLQRKEP PGKHWRKLVQM*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |