Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0311500_circ_g.1 |
ID in PlantcircBase | osa_circ_001509 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 11695290-11695462 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0311500 |
Parent gene annotation |
Similar to PHS1 (PROPYZAMIDE-HYPERSENSITIVE 1); phosphoprotein p hosphatase/ protein tyrosine/serine/threonine phosphatase. (Os01 t0311500-01);Similar to predicted protein. (Os01t0311500-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0311500-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.092967245 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11695420-11695458(+) 11695422-11695446(-) 11695385-11695460(-) |
Potential amino acid sequence |
MPSGSFSLFSAADLRWFLCYLVVISQRRHSRNGYHWYVNEVGHSGHQGSHAGIRGLKSCRVGVS HFSVQQT*(+) MTSILEFRRGNPDGRNAPLRLRTNDTHFSNVCAEISPPNNKETTLSLLH*(-) MAGMPHFVYVPMIPISRMSALRYHHQITKKPP*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |